Answered
How to do numerical multiple integral (more than triple) by using matlab?
You can eliminate the variables one by one until you feel comfortable. You can make down to 3 or 2 or 1 variable before final in...

12 years ago | 1

Answered
Matlab Triple Integration Error. Thank You
Replace out2 by out2 = integral3(yi, 0, Inf , 0, @(u3) u3 , 0, @(u3,u2) u2) If you want to use function handles as the ...

12 years ago | 1

| accepted

Answered
Randomly create lower and upper of matrix separately.
l = tril(rand(m,n),-1); % lower triangle u = triu(rand(m,n),1); % upper triangle d = diag(rand(1,m),0); % diagonal eleme...

12 years ago | 2

| accepted

Answered
How to rotate cube in MATLAB.?
Add the following lines of code at the bottom of your code: roll = -0.3064; pitch = -1.2258; yaw = 9.8066; dcm = angle2d...

12 years ago | 2

| accepted

Answered
How can i change values for my data in plot axis?
Replace t in plot by t/3600, that converts t from second to hour Add a text command with appropriate coordinate of the locati...

12 years ago | 2

| accepted

Answered
comparing matrix elements in order
A = [2000 500 300 300 1]'; A1 = sort(A,'descend'); if sum(A==A1)==length(A) disp('in order') else disp('not in...

12 years ago | 2

| accepted

Solved


Make one big string out of two smaller strings
If you have two small strings, like 'a' and 'b', return them put together like 'ab'. 'a' and 'b' => 'ab' For extra ...

12 years ago

Solved


Determine whether a vector is monotonically increasing
Return true if the elements of the input vector increase monotonically (i.e. each element is larger than the previous). Return f...

12 years ago

Answered
the number of occurences of each character of one string,in another
s = 'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVP...

12 years ago | 1

Answered
Constructing an approximate periodical function x(t) giving its Fourier series coefficient?
You can use a vectorized code to get the periodic signal: f0 = 1; % set the frequency of desired signal t = 0:0.01:8; ...

12 years ago | 1

Answered
Confusion Matrix Results Issue
The input arguments of confusion, (in this case, outputs and predictedOutput) should be in range of [0 1]. So, instead of 100 an...

12 years ago | 1

| accepted

Answered
how to sparse represent a image?
Convert a to double first, and the use that in sparse. Make sure that a is not in 3D, if so, then make it 2D before using in spa...

12 years ago | 2

| accepted

Answered
error with gmail sending
Make sure you are using some lines of code before using sendmail function: UserName = 'yourmail@gmail.com'; passWord = '...

12 years ago | 2

Answered
matrix operaions sums multiplications
It seems that A(:,3:end) are never used. If that is the case, then you can simply use a for loop: for k = 1:size(B,1) ...

12 years ago | 1

Answered
Selection of priority data
data=[3;4;8;NaN;NaN;NaN;7;4;3;NaN;NaN;2;3;NaN;9]; findNaN = find(isnan(data)); first = findNaN(1); numb...

12 years ago | 1

| accepted

Answered
selecting the last 60 rows in a matrix with an uncertain number of rows
last60rows = a(end-59:end,:)

12 years ago | 2

| accepted

Answered
I wanna define function which has flexible number of argument.
function out = F(varargin) % do stuffs % y = varargin{1}+varargin{2} % out = y+1; etc. For flexible number of...

12 years ago | 1

| accepted

Answered
Element to element Array Multiplication with all answers.
c = bsxfun(@times,a,B1) out = sum(c,2)

12 years ago | 1

| accepted

Answered
GUI I want to take datas from a struct into my listbox
There are multiple ways to do so. One of them: I assume you have a pushbutton to display in the names in the listbox. And if so,...

12 years ago | 1

| accepted

Answered
How to get only those output values which lie under a given curve!
Perhaps, you unconsciously mistyped the x coordinate of third point. I use 3800 instead of 2100, but use what the actual value i...

12 years ago | 1

| accepted

Answered
find power of signal
In time domain: for discrete signal x(n) Instantaneous power = |x(n)|^2 Average power = (1/N) * sum(|x(n)|.^2) N = data...

12 years ago | 2

| accepted

Answered
Image types and matrix multiplication
I guess I=Lena? And, T = load('Wav.mat'); % the .mat file you uploaded T1 = T.T1; ? If yes, then replace inverse ...

12 years ago | 1

Answered
Cumnwise multiplication between a matrix and a vector.
A = [1 2 3; 7 2 4; 2 0 4] B = [1 2 3] C = bsxfun(@times,A,B)

12 years ago | 1

| accepted

Answered
How to concatenate string vectors of unequal length?
v1 = {'a' 'b' 'c'}'; v2 = {'d'}'; v3 = {'e' 'f'}'; Lv1 = length(v1); Lv2 = length(v2); Lv3 = length(v3); n = max([...

12 years ago | 1

Answered
How to clear data from plot in matlab GUI, but then re-plot it without re-running the GUI
Use cla under the Callback function of your button. Don't use *clear all* command, as it clears all variables. Examples: cl...

12 years ago | 2

Answered
I have a circuit that I want to gain its transfer function.I've attached a JPG file.
Input voltage (across left C) = Vi Output voltage (across right C) = Vo Apply voltage divider rule in RL and C (at right) ...

12 years ago | 1

| accepted

Answered
Finding peaks in data based on certain threshold
Once I had to write a function for this type of problem in on of my projects. Seeing your question here, I have uploaded that fi...

12 years ago | 2

| accepted

Answered
How can I substitute a variable?
a= 5; syms x y = a*sin(x).^2 ./(sin(x) + cos(x)); subs ( y,{x},{2} )

12 years ago | 1

Answered
Count the index of the array
A=[0 0 0 0 0 0 0 0 0 10 0 0 0 0 15 0 17]; sum(A>0)

12 years ago | 2

Answered
integration of FFT
K_fourier is double type in your code. int cannot take double type as the function. @ Thorsten: int performs all symbolic, de...

12 years ago | 1

Load more